Excalimate logo

Excalimate

Unclaimed

by excalimate

Create keyframe animations from hand-drawn Excalidraw diagrams — timeline editor, camera animation, sequence reveals, and an MCP server for AI-driven creation with real-time live preview Export as MP4, WebM, GIF, or animated SVG.

Set up this server

01 / Choose your client

02 / Before you connect

Authentication is not specified. Check the project instructions before connecting.

Install the runtime required by the project and make it available to your client.

Project instructions

Use names from the project instructions, separated by commas. Enter names only, never secret values.

03 / Add the configuration

Source: generated from public install instructions

claude mcp add --transport stdio 'excalimate' -- 'npx' '-y' '@excalimate/mcp-server'

Run in your terminal after replacing any placeholders.

04 / Check it in your client

Open your client’s MCP settings and confirm the server connects and lists its tools. A copied configuration does not confirm a working connection.

aiai-toolsanimationdiagramexcalidrawexcalidraw-animationgifkeyframe-animationmcpmcp-servermodel-context-protocolmotion-designmp4reacttimelinetypescriptvitewhiteboard

More in AI & ML

Browse the full directory

Unclaimed listing

Is this your MCP server?

This listing was auto-indexed from the public record. Claim it to edit the page, set compatibility and unlock growth tools. Takes under two minutes.

Claim this server

Security profile

Claimed and verified servers get a weekly static scan that shows what the code can reach: external services, environment variables, shell commands, agent configuration folders, plus any dependencies with known advisories. Claim this listing to get one. How the security profile works

Tool change history

Compared across complete checks of the same configuration. Tools were listed, not invoked. Input-schema changes are not measured here.

No complete tool checks yet.

FAQ

Questions about Excalimate MCP Server

How do I connect Excalimate MCP Server to Claude?
Run `claude mcp add excalimate -- npx -y @excalimate/mcp-server` in Claude Code, or add the same command and arguments under mcpServers in Cursor's mcp.json or Claude Desktop's claude_desktop_config.json, then restart the client. The blocks above are ready to paste.
Is Excalimate MCP Server free?
The listed licence is MIT. Check the upstream terms for permitted use and commercial requirements; a public repository does not by itself mean the software is free or open source. Connected APIs and hosted services may have separate charges.
What can Excalimate MCP Server do?
MCPVault has not yet recorded the tool list for Excalimate MCP Server; it is captured when the server passes a live MCP handshake. The description above is what the project publishes.