How do I connect Hypruse MCP Server to Claude?

The listing records `claude mcp add -s user hypruse -- uvx hypruse` as its setup step. Run it, then follow the repository's instructions for the client configuration; the listing names Claude Desktop, Claude Code, Cursor as compatible clients.

Is Hypruse MCP Server free?

The listed licence is MIT. Check the upstream terms for permitted use and commercial requirements; a public repository does not by itself mean the software is free or open source. Connected APIs and hosted services may have separate charges.

What can Hypruse MCP Server do?

Hypruse MCP Server documents 16 tools to the agent, including binds, click_ui, clipboard. The descriptions above come from project documentation. A live handshake does not test individual tool behavior.

Hypruse

Unclaimed

by IlyasKhallouki

Computer use for Hyprland - MCP server giving AI agents native hands on your Wayland desktop. No ydotool, no root, no portals.

Install

$claude mcp add -s user hypruse -- uvx hypruse

Set up this server

Compare servers My Stack

This server needs project-specific setup. Follow the project instructions; no reusable public launch command is available yet.

Project instructions

ai-agentscomputer-usehyprlandmcpmcp-serverwayland

Is this your MCP server?

This listing was auto-indexed from the public record. Claim it to edit the page, set compatibility and unlock growth tools. Takes under two minutes.

Claim this server

Security profile

Claimed and verified servers get a weekly static scan that shows what the code can reach: external services, environment variables, shell commands, agent configuration folders, plus any dependencies with known advisories. Claim this listing to get one. How the security profile works

16 of 16 tools

Documented tools (16)

From project documentation. A server handshake does not verify each tool’s description or behavior.

binds

The user's own keybinds, decoded (SUPER+Q, action, description); the agent runs one with usebind

click_ui

Click a control by accessible NAME or by a marks number in one call: the coordinate comes from the tree, the click goes through the real pointer (visible, same safety guarantees); an ambiguous name returns the candidates instead of guessing

clipboard

Read or write the text clipboard via wl-clipboard; opt-in, exists only with HYPRUSECLIPBOARD=1 in the server env

desktop

One-call semantic snapshot: monitors, workspaces, windows (address/class/title/geometry), active window, cursor, and layer surfaces (launchers, bars, notification popups) with a best-effort kind and geometry

hypr

Switch workspace, focus/move/close windows, fullscreen, floating (pure IPC, milliseconds; closewindow also waits up to 1s for the destroy event, so its result and then= observation reflect the close instead of racing it)

keyboard

Type literal text (unicode-safe) or press app-level combos (ctrl+shift+t, esc, F5); optional window address focuses the target first so keystrokes land in the right app. Compositor binds (super+...) go through usebind, not here

launch

Start an app (optionally silent on another workspace), block on its actual openwindow event, return its address; detects single-instance apps (browsers) whose window ignores exec rules and moves it to the requested workspace

marks

Set-of-Marks capture: the window screenshot with every accessible control drawn as a numbered mark, plus a JSON legend (role, name, current value, exact click point per number); needs ImageMagick for the drawing, degrades to the legend alone without it

pointer

move / click / drag / scroll (discrete wheel notches) in global coordinates

screenshot

Focused monitor, exact window crop by address, or x,y,WxH region; returns image + coordinate-mapping metadata; fast JPEG by default (lossless=true for PNG); stable=true waits for the frame to settle

sequence

Run an ordered list of actions (pointer/keyboard/clickui/hypr/waitfor) in one call; stops the moment the desktop changes in a way the current step did not expect, so a click/type/enter micro-sequence costs one round-trip instead of several

tool

what it does

ui

Read a window's accessibility tree (AT-SPI, GTK/Qt apps that expose one) and return clickable elements by name with exact global coordinates, no screenshot; reports current values too (typed text, slider position, checkbox state); falls back to vision when an app exposes nothing

use_bind

Execute a keybind by combo (SUPER+F), running its bound action, so the agent drives the owner's own launchers and shortcuts. Not available for binds in a Lua hyprland.lua: those are anonymous closures Hyprland exposes no way to call, so binds shows them as action lua and usebind says so instead of f

wait_for

Block on real compositor events (window open/close, workspace change, title change, layer surfaces appearing/closing, urgency, screen sharing on/off) with a match filter and timeout; a filtered wait whose condition already holds (window already gone, workspace already active, layer already mapped) a

zoom

Native-resolution re-capture around an estimated point (optionally clamped to a window): the precision step before clicking small controls, same metadata contract

Tool change history

Compared across complete checks of the same configuration. Tools were listed, not invoked. Input-schema changes are not measured here.

No complete tool checks yet.

FAQ

Questions about Hypruse MCP Server

How do I connect Hypruse MCP Server to Claude?: The listing records `claude mcp add -s user hypruse -- uvx hypruse` as its setup step. Run it, then follow the repository's instructions for the client configuration; the listing names Claude Desktop, Claude Code, Cursor as compatible clients.
Is Hypruse MCP Server free?: The listed licence is MIT. Check the upstream terms for permitted use and commercial requirements; a public repository does not by itself mean the software is free or open source. Connected APIs and hosted services may have separate charges.
What can Hypruse MCP Server do?: Hypruse MCP Server documents 16 tools to the agent, including binds, click_ui, clipboard. The descriptions above come from project documentation. A live handshake does not test individual tool behavior.