How do I connect Visual Ui Debug Agent MCP Server to Claude?

Run `claude mcp add visual-ui-debug-agent-mcp -- npx -y visual-ui-debug-agent-mcp` in Claude Code, or add the same command and arguments under mcpServers in Cursor's mcp.json or Claude Desktop's claude_desktop_config.json, then restart the client. The blocks above are ready to paste.

Is Visual Ui Debug Agent MCP Server free?

The listed licence is ISC. Check the upstream terms for permitted use and commercial requirements; a public repository does not by itself mean the software is free or open source. Connected APIs and hosted services may have separate charges.

What can Visual Ui Debug Agent MCP Server do?

Visual Ui Debug Agent MCP Server documents 14 tools to the agent, including api_endpoint_tester, batch_screenshot_urls, console_monitor. The descriptions above come from project documentation. A live handshake does not test individual tool behavior.

Visual Ui Debug Agent MCP

Unclaimed

by samihalawa

Visual UI testing and debugging MCP server with Playwright, screenshots, DOM inspection, workflow validation, and visual diffs.

Set up this server

Compare servers My Stack

01 / Choose your client

02 / Before you connect

Authentication is not specified. Check the project instructions before connecting.

Install the runtime required by the project and make it available to your client.

Project instructionsEnvironment variable names (optional)

Use names from the project instructions, separated by commas. Enter names only, never secret values.

03 / Add the configuration

Source: generated from public install instructions

claude mcp add --transport stdio 'visual-ui-debug-agent-mcp' -- 'npx' '-y' 'visual-ui-debug-agent-mcp'

Run in your terminal after replacing any placeholders.

04 / Check it in your client

Open your client’s MCP settings and confirm the server connects and lists its tools. A copied configuration does not confirm a working connection.

agentaiautomatedautomationautonomous-agentsbrowserdebugginggptmcpmcp-serverplaywrighttypescriptuiui-testingvisual-testing

Is this your MCP server?

This listing was auto-indexed from the public record. Claim it to edit the page, set compatibility and unlock growth tools. Takes under two minutes.

Claim this server

Security profile

Claimed and verified servers get a weekly static scan that shows what the code can reach: external services, environment variables, shell commands, agent configuration folders, plus any dependencies with known advisories. Claim this listing to get one. How the security profile works

14 of 14 tools

Documented tools (14)

From project documentation. A server handshake does not verify each tool’s description or behavior.

api_endpoint_tester

Exercise multiple HTTP endpoints

batch_screenshot_urls

Capture multiple URLs for side-by-side review

console_monitor

Capture browser console messages over a time window

debug_memory

Keep small debugging notes during one server session

dom_inspector

Return element properties, children, and computed styles

enhanced_page_analyzer

Screenshot, console, performance, and interactive-element analysis

navigation_flow_validator

Validate a sequence of browser actions

performance_analysis

Collect navigation and page performance metrics

screenshot_local_files

Render and capture local HTML files

screenshot_url

Capture a URL, viewport, full page, or selected element

sitemap_crawler

Discover and inspect pages from a sitemap

tunnel_helper

Store or retrieve a remote tunnel URL and setup guidance

ui_workflow_validator

Execute and verify a described user journey

visual_comparison

Compare two rendered pages or elements

Tool change history

Compared across complete checks of the same configuration. Tools were listed, not invoked. Input-schema changes are not measured here.

No complete tool checks yet.

FAQ

Questions about Visual Ui Debug Agent MCP Server

How do I connect Visual Ui Debug Agent MCP Server to Claude?: Run `claude mcp add visual-ui-debug-agent-mcp -- npx -y visual-ui-debug-agent-mcp` in Claude Code, or add the same command and arguments under mcpServers in Cursor's mcp.json or Claude Desktop's claude_desktop_config.json, then restart the client. The blocks above are ready to paste.
Is Visual Ui Debug Agent MCP Server free?: The listed licence is ISC. Check the upstream terms for permitted use and commercial requirements; a public repository does not by itself mean the software is free or open source. Connected APIs and hosted services may have separate charges.
What can Visual Ui Debug Agent MCP Server do?: Visual Ui Debug Agent MCP Server documents 14 tools to the agent, including api_endpoint_tester, batch_screenshot_urls, console_monitor. The descriptions above come from project documentation. A live handshake does not test individual tool behavior.